PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G35260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 1787aa    MW: 200034 Da    PI: 5.1915
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G35260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox521.2e-16453857
                  -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
      Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                  +++qle+Le+ ++ ++yps++ r+eL++k+gL++rq ++WF+ rR k++k
  OB01G35260.1  4 SPYQLEVLEKTYAVEQYPSETLRAELSAKIGLSDRQLQMWFCHRRLKDRK 53
                  789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003895.4E-10158IPR001356Homeobox domain
PROSITE profilePS5007115.094154IPR001356Homeobox domain
SuperFamilySSF466898.55E-14353IPR009057Homeodomain-like
CDDcd000869.70E-13354No hitNo description
PfamPF000462.0E-14453IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.5E-15453IPR009057Homeodomain-like
SMARTSM005711.7E-14573632IPR018501DDT domain
PROSITE profilePS5082714.537573632IPR018501DDT domain
PfamPF027911.5E-13575629IPR018501DDT domain
PfamPF050669.3E-16749817IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.1E-99661008IPR028942WHIM1 domain
PfamPF156133.3E-1111431215IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1787 aa     Download sequence    Send to blast
MMKSPYQLEV LEKTYAVEQY PSETLRAELS AKIGLSDRQL QMWFCHRRLK DRKPPTKRQR  60
REEEAAAGPL MAPPPVLPPP TLPLASGELL ISGSSPYDEP PPMPPVHSRR GAGRSSAVPR  120
LSAPDIGRRY YEPLPVMLPP PVSSMQLTTS ELRVIHSVES QLGEPLREDG PVLGVEFDPL  180
PPGSFGAPIV PEQPKQPVRS YDTKIYSRHD SNLLKASAFF PSVEHPFVPN SIGGKRKLMV  240
GNPPVHPHAG SRAVHEYQFL PEQPSDRYEG SSRSRYYDTP VEASNSRMSS HTPGSQLLHG  300
SEEAALGYPF QGQISGSGLL PQSGRPEVLP AVPTDYEMIQ SNSNLNSVPV EGQYGISQVA  360
GFENSLLPSE RRAYHDEDGS RVDRKRKHNE EAKIAKEVEA HEKRIRKELE KQDMMKRKRE  420
EQMRKEMERH DRERRKEEER LLRERQREQE RFQREQRREH ERMEKFMQKQ SRRAEKQRQK  480
EELRKEKEAA RQKAANERAT ARRIAREYME LVEDERLELM ELAAQSKGLP SMLYLDSDTL  540
QQLDSFRGML SPFPPEVVRL KVPFSIKPWT VSEDNVGNLL MVWKFSITFA DFLGLSSVTL  600
DEFIQSLHDY DSRFLGELHI ALLKSIIKDI EDVSRTPSVA LGVNPGGGHP QIVEGAYAWG  660
FNIRSWQRHL NVLTWPEILR QLALSAGLGP QLKKRDAEDV YSRDDNEGHD GKIVISTLRN  720
GSAAVNAAAL MKERGYTNRR RSRHRLTPGT VKFAAFHVLS LEGSKGLTIL EVAERIQESG  780
LRDLTTSKTP EASISAALSR DTKLFERTAP STYCVKSPYR KDPADSEIVL SSAREKIRAF  840
HNVLSDSDAE KEADDAERDE DSECDDADDD PDGDDVNIDV GDGKDPLIGV KEQDGVPIMT  900
AVNSTQRVEE RVGTLTQPSA FTKSGKVDPN PSLDTSSDSP ARETSDYHEI APSDAEDQEI  960
DESNQGESWV QGLAEGDYCD LSVEERLNAL VALVGIANEG NSIRAVLEER LESANALKKQ  1020
MWAEAQHDKR RTKEEFASRV QYNSNMNLKA DVNQENGTES TTTPCRNVDK DNDGNAGVVN  1080
NNNEIIDHNS NAVNTSYERN GSGQDITATA DTLSVQQYAY ADKTRSQLRS YIGHRAEQLF  1140
VYRSLPLGQD RRRNRYWQCS TSASPNDPGS GRIFFESRDG YWRVLDSEEA FDSLVASLDT  1200
RGSREAQLHS MLQRIESTFK EAIKRKNGAV VEQSAGRYLK NGAMEMIRAS SRSEFGSPSS  1260
SLSGVTSDSA MAFSDSFKIE LGRNDVEKTA ISKRADGFIR WMWRECNDLK LTCAMKCGKK  1320
RCSELIHSCN YCYQIYLIEE RHCSSCHMIF KSIHNFSDHT SQCEEKRRTD HNWKMQTADH  1380
SVPVGMRLLK LQLSTIEASI PPEAIQPFWT DGYRKSWGVK LHSTASLEEI FQMLTLLEGA  1440
IKRDYLSSDF ETTNELLNIN TQDTASQNHV GLSGSGASLP WLPATTAAIA LRTLDLDSAV  1500
SYIQNQKMER DGGDFMKAPS RFAVVKNAQE LEPLEATGFD LYDGRLAAVS GRRGRGRGSR  1560
GGGSRGGRGR SRGGRVPRGI SSSSRIGFKD ENESSRKNAR RGRTTRGRRR GRRTVRPRQP  1620
SEGRGRSIPK ENLLGSFSML SNAKPATVEE SPRSSGADEW GLENRRPYIE GDENSSGSQL  1680
DQSEDNEENS QPMDEEYDEQ VPNFSRGYSS GSRPHGMIDD ESEEEDEDAE GDDDGEEDDV  1740
DHAVDDVDAE MDDDDDIGDD GEDGGDGAEA NADEDNGASS YSSEYSD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071290.0AK107129.1 Oryza sativa Japonica Group cDNA clone:002-124-C03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644503.20.0PREDICTED: homeobox-DDT domain protein RLT2-like
TrEMBLJ3L2S00.0J3L2S0_ORYBR; Uncharacterized protein
STRINGOB01G35260.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator